BLASTP 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Asclepias_syriaca_v0.3_proteins.fa 43,035 sequences; 19,571,512 total letters Query= Untitled_sequence Length=124 Score E Sequences producing significant alignments: (Bits) Value AS11g024750.1.1(joined) (translated) 245 5e-83 >AS11g024750.1.1 (joined) (translated) Length=309 Score = 245 bits (626), Expect = 5e-83, Method: Compositional matrix adjust. Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%) Query 6 FSFSTLPSFLKYLKAPRYFFFNKEDKFADPMALEALNSPTTPTPPVFQYENATLRYSIDQ 65 FSFSTLPSFLKYLKAPRYFFFNKEDKFADPMALEALNSPTTPTPPVFQYENATLRYSIDQ Sbjct 6 FSFSTLPSFLKYLKAPRYFFFNKEDKFADPMALEALNSPTTPTPPVFQYENATLRYSIDQ 65 Query 66 PWTKGKRSKRARSVEQPQPTEEEYLAWCLIMLARGGADAGGRSGGGASTLPAPPPPPPT 124 PWTKGKRSKRARSVEQPQPTEEEYLAWCLIMLARGGA AGGRSGGGASTLP+PPPPPPT Sbjct 66 PWTKGKRSKRARSVEQPQPTEEEYLAWCLIMLARGGAGAGGRSGGGASTLPSPPPPPPT 124 Lambda K H a alpha 0.316 0.135 0.422 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 533744308 Database: Asclepias_syriaca_v0.3_proteins.fa Posted date: Jun 11, 2021 2:00 PM Number of letters in database: 19,571,512 Number of sequences in database: 43,035 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40